5-FAM-LL-37 (scrambled) trifluoroacetate salt,CAS :2022972-73-0

Fluorescein-5-carbonyl-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-906	0.5mg	330.00	- +	+ Add to cart
R-M-906	1mg	570.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	2022972-73-0
Sequence	5-FAM-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Synonyms	Cationic Antimicrobial Protein 18 (134-170) 5-FAM labeled, (human), 5-FAM-hCAP-18 (134-170)
Molecular Formula	C₂₂₆H₃₅₀N₆₀O₅₉
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document